PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27267.8 Da    PI: 9.5516
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004785.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.97.3e-30959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++ rqvtf+kRrng+lKKA+ELSvLCdae+a++ifs++g+lyeys+
  Aco004785.1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEIALVIFSTRGRLYEYSN 59
                 79***********************************************95 PP

2K-box104.71.2e-3479173599
        K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  s++ +e + ++++qqe+akL+ +i+ Lq+ ++hl+Ge L++L+ keL+qLe++Le+++ +iRskK+e l+++ie++qk+e +lq++n+ Lr+k++
  Aco004785.1  79 SSSTVEVNSHQYYQQEAAKLRHQIQILQNANKHLMGEALSNLTAKELKQLENRLERGIARIRSKKHEQLFAEIEYMQKREADLQNDNMHLRAKIA 173
                  344489999************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.403161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-32276IPR002100Transcription factor, MADS-box
CDDcd002653.58E-44276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014863.8E-2683172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.92788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEIALVIFST RGRLYEYSNS  60
SIRSTIERYK KACSNSPNSS STVEVNSHQY YQQEAAKLRH QIQILQNANK HLMGEALSNL  120
TAKELKQLEN RLERGIARIR SKKHEQLFAE IEYMQKREAD LQNDNMHLRA KIADSERAQQ  180
ANIVSGGTEL DALPTFDSRN YYHVSMLDAA SHYSHHQDQT TLHLGYEIKA DPAAKNLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-20182180Myocyte-specific enhancer factor 2B
1tqe_R4e-20182180Myocyte-specific enhancer factor 2B
1tqe_Q4e-20182180Myocyte-specific enhancer factor 2B
1tqe_P4e-20182180Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908080.11e-153PREDICTED: MADS-box transcription factor 21-like
SwissprotQ8RU311e-115MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A076YHP61e-154A0A076YHP6_COCNU; AGAMOUS-like MADS-box protein
STRINGGSMUA_Achr7P23690_0011e-144(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-101MIKC_MADS family protein